Lineage for d11asb_ (11as B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214435Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1214436Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) (S)
  5. 1214437Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1214447Protein Asparagine synthetase [55705] (1 species)
  7. 1214448Species Escherichia coli [TaxId:562] [55706] (2 PDB entries)
  8. 1214452Domain d11asb_: 11as B: [40786]
    complexed with asn; mutant

Details for d11asb_

PDB Entry: 11as (more details), 2.5 Å

PDB Description: asparagine synthetase mutant c51a, c315a complexed with l-asparagine
PDB Compounds: (B:) asparagine synthetase

SCOPe Domain Sequences for d11asb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d11asb_ d.104.1.1 (B:) Asparagine synthetase {Escherichia coli [TaxId: 562]}
ayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvkalp
daqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwervm
gdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdldak
greraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwnpvl
edafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrltml
llqlphigqvqagvwpaavresvpsll

SCOPe Domain Coordinates for d11asb_:

Click to download the PDB-style file with coordinates for d11asb_.
(The format of our PDB-style files is described here.)

Timeline for d11asb_: