Lineage for d11asb_ (11as B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) 
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins) 
Protein Asparagine synthetase [55705] (1 species) Species Escherichia coli [TaxId:562] [55706] (2 PDB entries) 
Domain d11asb_: 11as B: [40786]
Details for d11asb_
PDB Entry: 11as (more details), 2.5 Å
PDB Description: asparagine synthetase mutant c51a, c315a complexed with l-asparagine
SCOP Domain Sequences for d11asb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d11asb_ d.104.1.1 (B:) Asparagine synthetase {Escherichia coli}
ayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvkalp
daqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwervm
gdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdldak
greraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwnpvl
edafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrltml
llqlphigqvqagvwpaavresvpsll
SCOP Domain Coordinates for d11asb_:
Click to download the PDB-style file with coordinates for d11asb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d11asb_:
- d11asb_ appears in SCOP 1.57
- d11asb_ appears in the current release, SCOPe 2.08
View in 3D
