Lineage for d11asb_ (11as B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34950Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 34951Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 34952Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins)
  6. 34953Protein Asparagine synthetase [55705] (1 species)
  7. 34954Species Escherichia coli [TaxId:562] [55706] (2 PDB entries)
  8. 34958Domain d11asb_: 11as B: [40786]

Details for d11asb_

PDB Entry: 11as (more details), 2.5 Å

PDB Description: asparagine synthetase mutant c51a, c315a complexed with l-asparagine

SCOP Domain Sequences for d11asb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d11asb_ d.104.1.1 (B:) Asparagine synthetase {Escherichia coli}
ayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvkalp
daqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwervm
gdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdldak
greraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwnpvl
edafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrltml
llqlphigqvqagvwpaavresvpsll

SCOP Domain Coordinates for d11asb_:

Click to download the PDB-style file with coordinates for d11asb_.
(The format of our PDB-style files is described here.)

Timeline for d11asb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d11asa_