SCOPe 2.08: Domain d11asb_: 11as B:

Lineage for d11asb_ (11as B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Asparagine synthetase [55705] (1 species)

7. Species Escherichia coli [TaxId:562] [55706] (2 PDB entries)

8. Domain d11asb_: 11as B: [40786]
   complexed with asn; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d11asb_

PDB Entry: 11as, 2.5 Å

PDB Description: asparagine synthetase mutant c51a, c315a complexed with l-asparagine

PDB Compounds: (B:) asparagine synthetase

SCOPe Domain Sequences for d11asb_:

Sequence; same for both SEQRES and ATOM records:

>d11asb_ d.104.1.1 (B:) Asparagine synthetase {Escherichia coli [TaxId: 562]}
ayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvkalp
daqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwervm
gdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdldak
greraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwnpvl
edafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrltml
llqlphigqvqagvwpaavresvpsll

Timeline for d11asb_:

• d11asb_ first appeared (with stable ids) in SCOP 1.55
  
• d11asb_ appears in SCOPe 2.07