Lineage for d11asa_ (11as A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136439Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 136440Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 136441Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (11 proteins)
  6. 136442Protein Asparagine synthetase [55705] (1 species)
  7. 136443Species Escherichia coli [TaxId:562] [55706] (2 PDB entries)
  8. 136446Domain d11asa_: 11as A: [40785]

Details for d11asa_

PDB Entry: 11as (more details), 2.5 Å

PDB Description: asparagine synthetase mutant c51a, c315a complexed with l-asparagine

SCOP Domain Sequences for d11asa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d11asa_ d.104.1.1 (A:) Asparagine synthetase {Escherichia coli}
ayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvkalp
daqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwervm
gdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdldak
greraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwnpvl
edafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrltml
llqlphigqvqagvwpaavresvpsll

SCOP Domain Coordinates for d11asa_:

Click to download the PDB-style file with coordinates for d11asa_.
(The format of our PDB-style files is described here.)

Timeline for d11asa_: