Lineage for d12asa_ (12as A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214435Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1214436Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) (S)
  5. 1214437Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1214447Protein Asparagine synthetase [55705] (1 species)
  7. 1214448Species Escherichia coli [TaxId:562] [55706] (2 PDB entries)
  8. 1214449Domain d12asa_: 12as A: [40783]
    complexed with amp, asn; mutant

Details for d12asa_

PDB Entry: 12as (more details), 2.2 Å

PDB Description: asparagine synthetase mutant c51a, c315a complexed with l-asparagine and amp
PDB Compounds: (A:) asparagine synthetase

SCOPe Domain Sequences for d12asa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d12asa_ d.104.1.1 (A:) Asparagine synthetase {Escherichia coli [TaxId: 562]}
ayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvkalp
daqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwervm
gdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdldak
greraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwnpvl
edafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrltml
llqlphigqvqagvwpaavresvpsll

SCOPe Domain Coordinates for d12asa_:

Click to download the PDB-style file with coordinates for d12asa_.
(The format of our PDB-style files is described here.)

Timeline for d12asa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d12asb_