SCOP 1.55: Domain d1eiyb5: 1eiy B:475-681

Lineage for d1eiyb5 (1eiy B:475-681)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins)

6. Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)

7. Species Thermus thermophilus (Thermus aquaticus) [55704] (4 PDB entries)

8. Domain d1eiyb5: 1eiy B:475-681 [40782]
   Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb6

Details for d1eiyb5

PDB Entry: 1eiy, 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe

SCOP Domain Sequences for d1eiyb5:

Sequence; same for both SEQRES and ATOM records:

>d1eiyb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus (Thermus aquaticus)}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

SCOP Domain Coordinates for d1eiyb5 are not available.

Timeline for d1eiyb5:

• d1eiyb5 appears in SCOP 1.57
  
• d1eiyb5 appears in the current release, SCOPe 2.08