SCOP 1.71: Domain d1b70b5: 1b70 B:475-681

Lineage for d1b70b5 (1b70 B:475-681)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)

6. Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
   this domain is non-catalytic

7. Species Thermus thermophilus (Thermus aquaticus) [55704] (5 PDB entries)

8. Domain d1b70b5: 1b70 B:475-681 [40781]
   Other proteins in same PDB: d1b70a_, d1b70b1, d1b70b2, d1b70b3, d1b70b4, d1b70b6

Details for d1b70b5

PDB Entry: 1b70, 2.7 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalanine

SCOP Domain Sequences for d1b70b5:

Sequence; same for both SEQRES and ATOM records:

>d1b70b5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus (Thermus aquaticus)}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

Timeline for d1b70b5:

• d1b70b5 first appeared (with stable ids) in SCOP 1.55
  
• d1b70b5 appears in SCOP 1.69
  
• d1b70b5 appears in SCOP 1.73
  
• d1b70b5 appears in the current release, SCOPe 2.08