Lineage for d1b7yb5 (1b7y B:475-681)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574233Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2574372Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
    this domain is non-catalytic
  7. 2574373Species Thermus thermophilus [TaxId:274] [55704] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 2574378Domain d1b7yb5: 1b7y B:475-681 [40780]
    Other proteins in same PDB: d1b7ya_, d1b7yb1, d1b7yb2, d1b7yb3, d1b7yb4, d1b7yb6
    protein/RNA complex; complexed with fya, mg

Details for d1b7yb5

PDB Entry: 1b7y (more details), 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate
PDB Compounds: (B:) protein (phenylalanyl-tRNA synthetase)

SCOPe Domain Sequences for d1b7yb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7yb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

SCOPe Domain Coordinates for d1b7yb5:

Click to download the PDB-style file with coordinates for d1b7yb5.
(The format of our PDB-style files is described here.)

Timeline for d1b7yb5: