SCOPe 2.03: Domain d1b7yb5: 1b7y B:475-681

Lineage for d1b7yb5 (1b7y B:475-681)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
   this domain is non-catalytic

7. Species Thermus thermophilus [TaxId:274] [55704] (11 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d1b7yb5: 1b7y B:475-681 [40780]
   Other proteins in same PDB: d1b7ya_, d1b7yb1, d1b7yb2, d1b7yb3, d1b7yb4, d1b7yb6
   protein/RNA complex; complexed with fya, mg

Details for d1b7yb5

PDB Entry: 1b7y, 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate

PDB Compounds: (B:) protein (phenylalanyl-tRNA synthetase)

SCOPe Domain Sequences for d1b7yb5:

Sequence; same for both SEQRES and ATOM records:

>d1b7yb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

Timeline for d1b7yb5:

• d1b7yb5 first appeared (with stable ids) in SCOP 1.55
  
• d1b7yb5 appears in SCOPe 2.02
  
• d1b7yb5 appears in SCOPe 2.04
  
• d1b7yb5 appears in the current release, SCOPe 2.08