Lineage for d1b7yb5 (1b7y B:475-681)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34950Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 34951Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 34952Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins)
  6. 35031Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
  7. 35032Species Thermus thermophilus (Thermus aquaticus) [55704] (4 PDB entries)
  8. 35034Domain d1b7yb5: 1b7y B:475-681 [40780]
    Other proteins in same PDB: d1b7ya_, d1b7yb1, d1b7yb2, d1b7yb3, d1b7yb4, d1b7yb6

Details for d1b7yb5

PDB Entry: 1b7y (more details), 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate

SCOP Domain Sequences for d1b7yb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7yb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus (Thermus aquaticus)}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

SCOP Domain Coordinates for d1b7yb5:

Click to download the PDB-style file with coordinates for d1b7yb5.
(The format of our PDB-style files is described here.)

Timeline for d1b7yb5: