Lineage for d1pysb5 (1pys B:475-681)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663707Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1663708Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1663709Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1663847Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
    this domain is non-catalytic
  7. 1663848Species Thermus thermophilus [TaxId:274] [55704] (11 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1663850Domain d1pysb5: 1pys B:475-681 [40779]
    Other proteins in same PDB: d1pysa_, d1pysb1, d1pysb2, d1pysb3, d1pysb4, d1pysb6
    complexed with mg

Details for d1pysb5

PDB Entry: 1pys (more details), 2.9 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus
PDB Compounds: (B:) phenylalanyl-tRNA synthetase

SCOPe Domain Sequences for d1pysb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pysb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

SCOPe Domain Coordinates for d1pysb5:

Click to download the PDB-style file with coordinates for d1pysb5.
(The format of our PDB-style files is described here.)

Timeline for d1pysb5: