SCOP 1.55: Domain d1pysb5: 1pys B:475-681

Lineage for d1pysb5 (1pys B:475-681)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins)

6. Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)

7. Species Thermus thermophilus (Thermus aquaticus) [55704] (4 PDB entries)

8. Domain d1pysb5: 1pys B:475-681 [40779]
   Other proteins in same PDB: d1pysa_, d1pysb1, d1pysb2, d1pysb3, d1pysb4, d1pysb6

Details for d1pysb5

PDB Entry: 1pys, 2.9 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1pysb5:

Sequence; same for both SEQRES and ATOM records:

>d1pysb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus (Thermus aquaticus)}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

Timeline for d1pysb5:

• d1pysb5 appears in SCOP 1.57
  
• d1pysb5 appears in the current release, SCOPe 2.08