Lineage for d1eiya2 (1eiy A:85-350)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208547Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2208672Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 2208673Species Thermus thermophilus [TaxId:274] [55702] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 2208685Domain d1eiya2: 1eiy A:85-350 [40778]
    Other proteins in same PDB: d1eiya1, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6
    protein/RNA complex

Details for d1eiya2

PDB Entry: 1eiy (more details), 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe
PDB Compounds: (A:) phenylalanyl-tRNA synthetase

SCOPe Domain Sequences for d1eiya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiya2 d.104.1.1 (A:85-350) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

SCOPe Domain Coordinates for d1eiya2:

Click to download the PDB-style file with coordinates for d1eiya2.
(The format of our PDB-style files is described here.)

Timeline for d1eiya2: