Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species) |
Species Thermus thermophilus [TaxId:274] [55702] (9 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
Domain d1eiya2: 1eiy A:85-350 [40778] Other proteins in same PDB: d1eiya1, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6 protein/RNA complex |
PDB Entry: 1eiy (more details), 3.3 Å
SCOPe Domain Sequences for d1eiya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eiya2 d.104.1.1 (A:85-350) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam lrygipdiryffggrlkfleqfkgvl
Timeline for d1eiya2: