SCOP 1.55: Domain d1eiya2: 1eiy A:85-350

Lineage for d1eiya2 (1eiy A:85-350)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins)

6. Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)

7. Species Thermus thermophilus and (Thermus aquaticus) [55702] (4 PDB entries)

8. Domain d1eiya2: 1eiy A:85-350 [40778]
   Other proteins in same PDB: d1eiya1, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6

Details for d1eiya2

PDB Entry: 1eiy, 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe

SCOP Domain Sequences for d1eiya2:

Sequence; same for both SEQRES and ATOM records:

>d1eiya2 d.104.1.1 (A:85-350) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus and (Thermus aquaticus)}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

SCOP Domain Coordinates for d1eiya2 are not available.

Timeline for d1eiya2:

• d1eiya2 appears in SCOP 1.57
  
• d1eiya2 appears in the current release, SCOPe 2.08