Lineage for d1eiya2 (1eiy A:85-350)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34950Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 34951Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 34952Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins)
  6. 35025Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 35026Species Thermus thermophilus and (Thermus aquaticus) [55702] (4 PDB entries)
  8. Domain d1eiya2: 1eiy A:85-350 [40778]
    Other proteins in same PDB: d1eiya1, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6

Details for d1eiya2

PDB Entry: 1eiy (more details), 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe

SCOP Domain Sequences for d1eiya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiya2 d.104.1.1 (A:85-350) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus and (Thermus aquaticus)}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

SCOP Domain Coordinates for d1eiya2 are not available.

Timeline for d1eiya2:

Domains from same chain:
(mouse over for more information)
d1eiya1
Domains from other chains:
(mouse over for more information)
d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6