Lineage for d1b70a_ (1b70 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574233Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2574358Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 2574359Species Thermus thermophilus [TaxId:274] [55702] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 2574368Domain d1b70a_: 1b70 A: [40777]
    Other proteins in same PDB: d1b70b1, d1b70b2, d1b70b3, d1b70b4, d1b70b5, d1b70b6
    protein/RNA complex; complexed with mg, phe

Details for d1b70a_

PDB Entry: 1b70 (more details), 2.7 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalanine
PDB Compounds: (A:) phenylalanyl-tRNA synthetase

SCOPe Domain Sequences for d1b70a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b70a_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
vdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhpa
rdmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfrf
eqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepga
qfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlaml
rygipdiryffggrlkfleqfkgvl

SCOPe Domain Coordinates for d1b70a_:

Click to download the PDB-style file with coordinates for d1b70a_.
(The format of our PDB-style files is described here.)

Timeline for d1b70a_: