| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
| Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
| Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species) |
| Species Thermus thermophilus [TaxId:274] [55702] (11 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
| Domain d1b70a_: 1b70 A: [40777] Other proteins in same PDB: d1b70b1, d1b70b2, d1b70b3, d1b70b4, d1b70b5, d1b70b6 protein/RNA complex; complexed with mg, phe |
PDB Entry: 1b70 (more details), 2.7 Å
SCOPe Domain Sequences for d1b70a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b70a_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
vdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhpa
rdmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfrf
eqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepga
qfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlaml
rygipdiryffggrlkfleqfkgvl
Timeline for d1b70a_: