Lineage for d1b7ya_ (1b7y A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208547Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2208672Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 2208673Species Thermus thermophilus [TaxId:274] [55702] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 2208678Domain d1b7ya_: 1b7y A: [40776]
    Other proteins in same PDB: d1b7yb1, d1b7yb2, d1b7yb3, d1b7yb4, d1b7yb5, d1b7yb6
    protein/RNA complex; complexed with fya, mg

Details for d1b7ya_

PDB Entry: 1b7y (more details), 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate
PDB Compounds: (A:) protein (phenylalanyl-tRNA synthetase)

SCOPe Domain Sequences for d1b7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7ya_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
vdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhpa
rdmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfrf
eqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepga
qfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlaml
rygipdiryffggrlkfleqfkgvl

SCOPe Domain Coordinates for d1b7ya_:

Click to download the PDB-style file with coordinates for d1b7ya_.
(The format of our PDB-style files is described here.)

Timeline for d1b7ya_: