Lineage for d1b7ya_ (1b7y A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136439Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 136440Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 136441Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (11 proteins)
  6. 136517Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 136518Species Thermus thermophilus and (Thermus aquaticus) [55702] (5 PDB entries)
  8. 136521Domain d1b7ya_: 1b7y A: [40776]
    Other proteins in same PDB: d1b7yb1, d1b7yb2, d1b7yb3, d1b7yb4, d1b7yb5, d1b7yb6

Details for d1b7ya_

PDB Entry: 1b7y (more details), 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate

SCOP Domain Sequences for d1b7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7ya_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus and (Thermus aquaticus)}
vdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhpa
rdmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfrf
eqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepga
qfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlaml
rygipdiryffggrlkfleqfkgvl

SCOP Domain Coordinates for d1b7ya_:

Click to download the PDB-style file with coordinates for d1b7ya_.
(The format of our PDB-style files is described here.)

Timeline for d1b7ya_: