Lineage for d1pysa_ (1pys A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663707Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1663708Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1663709Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1663834Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species)
  7. 1663835Species Thermus thermophilus [TaxId:274] [55702] (11 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1663837Domain d1pysa_: 1pys A: [40775]
    Other proteins in same PDB: d1pysb1, d1pysb2, d1pysb3, d1pysb4, d1pysb5, d1pysb6
    complexed with mg

Details for d1pysa_

PDB Entry: 1pys (more details), 2.9 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus
PDB Compounds: (A:) phenylalanyl-tRNA synthetase

SCOPe Domain Sequences for d1pysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pysa_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl

SCOPe Domain Coordinates for d1pysa_:

Click to download the PDB-style file with coordinates for d1pysa_.
(The format of our PDB-style files is described here.)

Timeline for d1pysa_: