| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
| Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
| Protein Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS [55701] (1 species) |
| Species Thermus thermophilus [TaxId:274] [55702] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
| Domain d1pysa_: 1pys A: [40775] Other proteins in same PDB: d1pysb1, d1pysb2, d1pysb3, d1pysb4, d1pysb5, d1pysb6 complexed with mg |
PDB Entry: 1pys (more details), 2.9 Å
SCOPe Domain Sequences for d1pysa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pysa_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]}
rvdvslpgaslfsgglhpitlmerelveifralgyqavegpeveseffnfdalnipehhp
ardmwdtfwltgegfrlegplgeevegrlllrthtspmqvrymvahtppfrivvpgrvfr
feqtdatheavfhqleglvvgegiamahlkgaiyelaqalfgpdskvrfqpvyfpfvepg
aqfavwwpeggkwlelggagmvhpkvfqavdayrerlglppayrgvtgfafglgverlam
lrygipdiryffggrlkfleqfkgvl
Timeline for d1pysa_: