Lineage for d1dzsc_ (1dzs C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. Protein MS2 virus coat protein [55407] (1 species)
  7. Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
    Uniprot P03612
  8. Domain d1dzsc_: 1dzs C: [407741]
    automated match to d1u1ya_
    protein/RNA complex

Details for d1dzsc_

PDB Entry: 1dzs (more details), 2.85 Å

PDB Description: ms2-rna hairpin (4one-5) complex
PDB Compounds: (C:) protein (capsid protein ms2)

SCOPe Domain Sequences for d1dzsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzsc_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d1dzsc_ are not available.

Timeline for d1dzsc_:

  • d1dzsc_ is new in SCOPe 2.08-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d1dzsa_, d1dzsb_