Lineage for d1efwa3 (1efw A:105-294,A:415-580)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416610Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 416611Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 416612Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (14 proteins)
  6. 416622Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)
  7. 416639Species Thermus thermophilus, AspRS-1 [TaxId:274] [55700] (3 PDB entries)
  8. 416644Domain d1efwa3: 1efw A:105-294,A:415-580 [40773]
    Other proteins in same PDB: d1efwa1, d1efwa2, d1efwb1, d1efwb2

Details for d1efwa3

PDB Entry: 1efw (more details), 3 Å

PDB Description: Crystal structure of aspartyl-tRNA synthetase from Thermus thermophilus complexed to tRNAasp from Escherichia coli

SCOP Domain Sequences for d1efwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efwa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1}
tppfpvdagwrgeeekeaseelrlkyryldlrrrrmqenlrlrhrvikaiwdfldregfv
qvetpfltkstpegardflvpyrhepglfyalpqspqlfkqmlmvagldryfqiarcfrd
edlradrqpdftqldlemsfvevedvlelnerlmahvfrealgvelplpfprlsyeeame
rygsdkpdlrXregfrflwvvdfpllewdeeeeawtymhhpftsphpedlpllekdpgrv
ralaydlvlngvevgggsirihdprlqarvfrllgigeeeqrekfgfflealeygapphg
giawgldrllalmtgspsireviafpknkegkdpltgapspvpeeqlrelglmvvrp

SCOP Domain Coordinates for d1efwa3:

Click to download the PDB-style file with coordinates for d1efwa3.
(The format of our PDB-style files is described here.)

Timeline for d1efwa3: