![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.1: ALDH-like [53721] (6 proteins) |
![]() | Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species) |
![]() | Species Vibrio harveyi [TaxId:669] [53730] (4 PDB entries) |
![]() | Domain d1cbza_: 1cbz A: [407726] automated match to d1co3a_ complexed with nap |
PDB Entry: 1cbz (more details), 2.5 Å
SCOPe Domain Sequences for d1cbza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cbza_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} qtdnvfyatnaftgealplafpvhtevevnqaataaakvardfrrlnnskrasllrtias elearsddiiarahletalpevrltgeiartanqlrlfadvvnsgsyhqaildtpnptra plpkpdirrqqialgpvavfgasnfplafsaaggdtasalaagcpvivkghtahpgtsqi vaecieqalkqeqlpqaiftllqgnqralgqalvshpeikavgftgsvgggralfnlahe rpepipfygelgainptfifpsamrakadladqfvasmtmgcgqfctkpgvvfalntpet qafietaqslirqqspstlltpgirdsyqsqvvsrgsddgidvtfsqaespcvasalfvt ssenwrkhpaweeeifgpqslivvcenvadmlslsemlagsltatihateedypqvsqli prleeiagrlvfngwptevevgyamvhggpypasthsastsvgaeaihrwlrpvayqalp esllpdslkaenpleiaravdgkaa
Timeline for d1cbza_: