SCOPe 2.08: Domain d1b6nb_: 1b6n B:

Lineage for d1b6nb_ (1b6n B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 (arv2/sf2 isolate) [311116] (2 PDB entries)

8. Domain d1b6nb_: 1b6n B: [407720]
   automated match to d1b6ka_
   complexed with pi3, so4

Details for d1b6nb_

PDB Entry: 1b6n, 1.85 Å

PDB Description: hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 3

PDB Compounds: (B:) retropepsin

SCOPe Domain Sequences for d1b6nb_:

Sequence; same for both SEQRES and ATOM records:

>d1b6nb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (arv2/sf2 isolate)}
pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d1b6nb_:

• d1b6nb_ is new in SCOPe 2.08-stable