Lineage for d1g51b3 (1g51 B:1105-1294,B:1415-1580)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332805Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 332806Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 332807Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins)
  6. 332814Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)
  7. 332831Species Thermus thermophilus, AspRS-1 [TaxId:274] [55700] (3 PDB entries)
  8. 332833Domain d1g51b3: 1g51 B:1105-1294,B:1415-1580 [40772]
    Other proteins in same PDB: d1g51a1, d1g51a2, d1g51b1, d1g51b2
    complexed with amo, amp, so4

Details for d1g51b3

PDB Entry: 1g51 (more details), 2.4 Å

PDB Description: aspartyl trna synthetase from thermus thermophilus at 2.4 a resolution

SCOP Domain Sequences for d1g51b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g51b3 d.104.1.1 (B:1105-1294,B:1415-1580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1}
tppfpvdagwrgeeekeaseelrlkyryldlrrrrmqenlrlrhrvikaiwdfldregfv
qvetpfltkstpegardflvpyrhepglfyalpqspqlfkqmlmvagldryfqiarcfrd
edlradrqpdftqldlemsfvevedvlelnerlmahvfrealgvelplpfprlsyeeame
rygsdkpdlrXregfrflwvvdfpllewdeeeeawtymhhpftsphpedlpllekdpgrv
ralaydlvlngvevgggsirihdprlqarvfrllgigeeeqrekfgfflealeygapphg
giawgldrllalmtgspsireviafpknkegkdpltgapspvpeeqlrelglmvvrp

SCOP Domain Coordinates for d1g51b3:

Click to download the PDB-style file with coordinates for d1g51b3.
(The format of our PDB-style files is described here.)

Timeline for d1g51b3: