SCOP 1.65: Domain d1g51b3: 1g51 B:1105-1294,B:1415-1580

Lineage for d1g51b3 (1g51 B:1105-1294,B:1415-1580)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins)

6. Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)

7. Species Thermus thermophilus, AspRS-1 [TaxId:274] [55700] (3 PDB entries)

8. Domain d1g51b3: 1g51 B:1105-1294,B:1415-1580 [40772]
   Other proteins in same PDB: d1g51a1, d1g51a2, d1g51b1, d1g51b2
   complexed with amo, amp, so4

Details for d1g51b3

PDB Entry: 1g51, 2.4 Å

PDB Description: aspartyl trna synthetase from thermus thermophilus at 2.4 a resolution

SCOP Domain Sequences for d1g51b3:

Sequence; same for both SEQRES and ATOM records:

>d1g51b3 d.104.1.1 (B:1105-1294,B:1415-1580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1}
tppfpvdagwrgeeekeaseelrlkyryldlrrrrmqenlrlrhrvikaiwdfldregfv
qvetpfltkstpegardflvpyrhepglfyalpqspqlfkqmlmvagldryfqiarcfrd
edlradrqpdftqldlemsfvevedvlelnerlmahvfrealgvelplpfprlsyeeame
rygsdkpdlrXregfrflwvvdfpllewdeeeeawtymhhpftsphpedlpllekdpgrv
ralaydlvlngvevgggsirihdprlqarvfrllgigeeeqrekfgfflealeygapphg
giawgldrllalmtgspsireviafpknkegkdpltgapspvpeeqlrelglmvvrp

Timeline for d1g51b3:

• d1g51b3 first appeared (with stable ids) in SCOP 1.55
  
• d1g51b3 appears in SCOP 1.63
  
• d1g51b3 appears in SCOP 1.67
  
• d1g51b3 appears in the current release, SCOPe 2.08