Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species) |
Species Thermus thermophilus, AspRS-1 [TaxId:274] [55700] (3 PDB entries) |
Domain d1g51a3: 1g51 A:105-294,A:415-580 [40771] Other proteins in same PDB: d1g51a1, d1g51a2, d1g51b1, d1g51b2 complexed with amo, amp, so4 |
PDB Entry: 1g51 (more details), 2.4 Å
SCOPe Domain Sequences for d1g51a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g51a3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} tppfpvdagwrgeeekeaseelrlkyryldlrrrrmqenlrlrhrvikaiwdfldregfv qvetpfltkstpegardflvpyrhepglfyalpqspqlfkqmlmvagldryfqiarcfrd edlradrqpdftqldlemsfvevedvlelnerlmahvfrealgvelplpfprlsyeeame rygsdkpdlrXregfrflwvvdfpllewdeeeeawtymhhpftsphpedlpllekdpgrv ralaydlvlngvevgggsirihdprlqarvfrllgigeeeqrekfgfflealeygapphg giawgldrllalmtgspsireviafpknkegkdpltgapspvpeeqlrelglmvvrp
Timeline for d1g51a3: