Lineage for d1g51a3 (1g51 A:105-294,A:415-580)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416610Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 416611Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 416612Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (14 proteins)
  6. 416622Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)
  7. 416639Species Thermus thermophilus, AspRS-1 [TaxId:274] [55700] (3 PDB entries)
  8. 416642Domain d1g51a3: 1g51 A:105-294,A:415-580 [40771]
    Other proteins in same PDB: d1g51a1, d1g51a2, d1g51b1, d1g51b2

Details for d1g51a3

PDB Entry: 1g51 (more details), 2.4 Å

PDB Description: aspartyl trna synthetase from thermus thermophilus at 2.4 a resolution

SCOP Domain Sequences for d1g51a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g51a3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1}
tppfpvdagwrgeeekeaseelrlkyryldlrrrrmqenlrlrhrvikaiwdfldregfv
qvetpfltkstpegardflvpyrhepglfyalpqspqlfkqmlmvagldryfqiarcfrd
edlradrqpdftqldlemsfvevedvlelnerlmahvfrealgvelplpfprlsyeeame
rygsdkpdlrXregfrflwvvdfpllewdeeeeawtymhhpftsphpedlpllekdpgrv
ralaydlvlngvevgggsirihdprlqarvfrllgigeeeqrekfgfflealeygapphg
giawgldrllalmtgspsireviafpknkegkdpltgapspvpeeqlrelglmvvrp

SCOP Domain Coordinates for d1g51a3:

Click to download the PDB-style file with coordinates for d1g51a3.
(The format of our PDB-style files is described here.)

Timeline for d1g51a3: