Lineage for d6zuta1 (6zut A:7-166)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771729Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)
  7. 2771730Species Achromobacter cycloclastes [TaxId:223] [419324] (51 PDB entries)
  8. 2771738Domain d6zuta1: 6zut A:7-166 [407682]
    Other proteins in same PDB: d6zuta2
    automated match to d5i6la1
    complexed with cu, mli, no, so4

Details for d6zuta1

PDB Entry: 6zut (more details), 1.15 Å

PDB Description: cu nitrite reductase msox series at 170k, dose point 5
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d6zuta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zuta1 b.6.1.3 (A:7-166) Nitrite reductase, NIR, N-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
vdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfng
svpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfka
tkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

SCOPe Domain Coordinates for d6zuta1:

Click to download the PDB-style file with coordinates for d6zuta1.
(The format of our PDB-style files is described here.)

Timeline for d6zuta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6zuta2