Lineage for d1eqra3 (1eqr A:107-287,A:421-590)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1920670Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1920687Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)
  7. 1920694Species Escherichia coli [TaxId:562] [55699] (3 PDB entries)
  8. 1920698Domain d1eqra3: 1eqr A:107-287,A:421-590 [40768]
    Other proteins in same PDB: d1eqra1, d1eqra2, d1eqrb1, d1eqrb2, d1eqrc1, d1eqrc2
    complexed with mg

Details for d1eqra3

PDB Entry: 1eqr (more details), 2.7 Å

PDB Description: crystal structure of free aspartyl-trna synthetase from escherichia coli
PDB Compounds: (A:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1eqra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqra3 d.104.1.1 (A:107-287,A:421-590) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]}
vlpldsnhvnteearlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmlt
katpegardylvpsrvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrq
peftqidvetsfmtapqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdl
rXdeskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmvi
ngyevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrl
tmlltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvkkaenn

SCOPe Domain Coordinates for d1eqra3:

Click to download the PDB-style file with coordinates for d1eqra3.
(The format of our PDB-style files is described here.)

Timeline for d1eqra3: