SCOPe 2.02: Domain d1c0aa3: 1c0a A:107-287,A:421-585

Lineage for d1c0aa3 (1c0a A:107-287,A:421-585)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)

7. Species Escherichia coli [TaxId:562] [55699] (3 PDB entries)

8. Domain d1c0aa3: 1c0a A:107-287,A:421-585 [40767]
   Other proteins in same PDB: d1c0aa1, d1c0aa2
   protein/RNA complex; complexed with amo, amp, so4

Details for d1c0aa3

PDB Entry: 1c0a, 2.4 Å

PDB Description: crystal structure of the e. coli aspartyl-trna synthetase : trnaasp : aspartyl-adenylate complex

PDB Compounds: (A:) aspartyl tRNA synthetase

SCOPe Domain Sequences for d1c0aa3:

Sequence; same for both SEQRES and ATOM records:

>d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]}
vlpldsnhvnteearlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmlt
katpegardylvpsrvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrq
peftqidvetsfmtapqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdl
rXdeskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmvi
ngyevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrl
tmlltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvk

Timeline for d1c0aa3:

• d1c0aa3 first appeared (with stable ids) in SCOP 1.55
  
• d1c0aa3 appears in SCOPe 2.01
  
• d1c0aa3 appears in SCOPe 2.03
  
• d1c0aa3 appears in the current release, SCOPe 2.08