Lineage for d1c0aa3 (1c0a A:107-287,A:421-585)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2967618Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2967635Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)
  7. 2967642Species Escherichia coli [TaxId:562] [55699] (3 PDB entries)
  8. 2967643Domain d1c0aa3: 1c0a A:107-287,A:421-585 [40767]
    Other proteins in same PDB: d1c0aa1, d1c0aa2
    protein/RNA complex; complexed with amo, amp, so4
    has additional insertions and/or extensions that are not grouped together

Details for d1c0aa3

PDB Entry: 1c0a (more details), 2.4 Å

PDB Description: crystal structure of the e. coli aspartyl-trna synthetase : trnaasp : aspartyl-adenylate complex
PDB Compounds: (A:) aspartyl tRNA synthetase

SCOPe Domain Sequences for d1c0aa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]}
vlpldsnhvnteearlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmlt
katpegardylvpsrvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrq
peftqidvetsfmtapqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdl
rXdeskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmvi
ngyevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrl
tmlltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvk

SCOPe Domain Coordinates for d1c0aa3:

Click to download the PDB-style file with coordinates for d1c0aa3.
(The format of our PDB-style files is described here.)

Timeline for d1c0aa3: