Lineage for d1b8ab2 (1b8a B:1104-1438)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34950Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 34951Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 34952Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins)
  6. 34959Protein Aspartyl-tRNA synthetase (AspRS) [55696] (4 species)
  7. 34971Species Pyrococcus kodakaraensis [TaxId:311400] [55698] (1 PDB entry)
  8. 34973Domain d1b8ab2: 1b8a B:1104-1438 [40766]
    Other proteins in same PDB: d1b8aa1, d1b8ab1

Details for d1b8ab2

PDB Entry: 1b8a (more details), 1.9 Å

PDB Description: aspartyl-trna synthetase

SCOP Domain Sequences for d1b8ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8ab2 d.104.1.1 (B:1104-1438) Aspartyl-tRNA synthetase (AspRS) {Pyrococcus kodakaraensis}
plpldptgkvkaeldtrlnnrfmdlrrpevmaifkirssvfkavrdffhengfieihtpk
iiatateggtelfpmkyfeedaflaespqlykeimmasgldrvyeiapifraeehnttrh
lneawsidsemafiedeeevmsflerlvahainyvrehnakeldilnfeleepklpfprv
sydkaleilgdlgkeipwgedidtegerllgkymmenenaplyflyqypseakpfyimky
dnkpeicrafdleyrgveissggqrehrhdilveqikekglnpesfefylkafrygmpph
ggfglgaerlikqmldlpnirevilfprdrrrltp

SCOP Domain Coordinates for d1b8ab2:

Click to download the PDB-style file with coordinates for d1b8ab2.
(The format of our PDB-style files is described here.)

Timeline for d1b8ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b8ab1