Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins) common fold is rather distorted |
Protein Isopenicillin N synthase [51199] (3 species) |
Species Emericella nidulans [TaxId:227321] [407419] (13 PDB entries) |
Domain d6zw8a_: 6zw8 A: [407652] automated match to d1bk0a_ complexed with acv, cd, gol, so4 |
PDB Entry: 6zw8 (more details), 1.22 Å
SCOPe Domain Sequences for d6zw8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zw8a_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans [TaxId: 227321]} svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep ngksdreplsygdylqnglvslinkngqt
Timeline for d6zw8a_: