Lineage for d6zw8a_ (6zw8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2815434Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins)
    common fold is rather distorted
  6. 2815464Protein Isopenicillin N synthase [51199] (3 species)
  7. 2815497Species Emericella nidulans [TaxId:227321] [407419] (13 PDB entries)
  8. 2815498Domain d6zw8a_: 6zw8 A: [407652]
    automated match to d1bk0a_
    complexed with acv, cd, gol, so4

Details for d6zw8a_

PDB Entry: 6zw8 (more details), 1.22 Å

PDB Description: isopenicillin n synthase in complex with cd and acv.
PDB Compounds: (A:) isopenicillin n synthase

SCOPe Domain Sequences for d6zw8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zw8a_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans [TaxId: 227321]}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

SCOPe Domain Coordinates for d6zw8a_:

Click to download the PDB-style file with coordinates for d6zw8a_.
(The format of our PDB-style files is described here.)

Timeline for d6zw8a_: