Lineage for d1b8aa2 (1b8a A:104-438)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 260809Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 260810Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 260811Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins)
  6. 260818Protein Aspartyl-tRNA synthetase (AspRS) [55696] (4 species)
  7. 260819Species Archaeon Pyrococcus kodakaraensis [TaxId:311400] [55698] (1 PDB entry)
  8. 260820Domain d1b8aa2: 1b8a A:104-438 [40765]
    Other proteins in same PDB: d1b8aa1, d1b8ab1

Details for d1b8aa2

PDB Entry: 1b8a (more details), 1.9 Å

PDB Description: aspartyl-trna synthetase

SCOP Domain Sequences for d1b8aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis}
plpldptgkvkaeldtrlnnrfmdlrrpevmaifkirssvfkavrdffhengfieihtpk
iiatateggtelfpmkyfeedaflaespqlykeimmasgldrvyeiapifraeehnttrh
lneawsidsemafiedeeevmsflerlvahainyvrehnakeldilnfeleepklpfprv
sydkaleilgdlgkeipwgedidtegerllgkymmenenaplyflyqypseakpfyimky
dnkpeicrafdleyrgveissggqrehrhdilveqikekglnpesfefylkafrygmpph
ggfglgaerlikqmldlpnirevilfprdrrrltp

SCOP Domain Coordinates for d1b8aa2:

Click to download the PDB-style file with coordinates for d1b8aa2.
(The format of our PDB-style files is described here.)

Timeline for d1b8aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b8aa1