![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) ![]() |
![]() | Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins) |
![]() | Protein Aspartyl-tRNA synthetase (AspRS) [55696] (4 species) |
![]() | Species Pyrococcus kodakaraensis [TaxId:311400] [55698] (1 PDB entry) |
![]() | Domain d1b8aa2: 1b8a A:104-438 [40765] Other proteins in same PDB: d1b8aa1, d1b8ab1 |
PDB Entry: 1b8a (more details), 1.9 Å
SCOP Domain Sequences for d1b8aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Pyrococcus kodakaraensis} plpldptgkvkaeldtrlnnrfmdlrrpevmaifkirssvfkavrdffhengfieihtpk iiatateggtelfpmkyfeedaflaespqlykeimmasgldrvyeiapifraeehnttrh lneawsidsemafiedeeevmsflerlvahainyvrehnakeldilnfeleepklpfprv sydkaleilgdlgkeipwgedidtegerllgkymmenenaplyflyqypseakpfyimky dnkpeicrafdleyrgveissggqrehrhdilveqikekglnpesfefylkafrygmpph ggfglgaerlikqmldlpnirevilfprdrrrltp
Timeline for d1b8aa2: