SCOPe 2.08: Domain d1b8aa2: 1b8a A:104-438

Lineage for d1b8aa2 (1b8a A:104-438)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)

7. Species Pyrococcus kodakaraensis [TaxId:311400] [55698] (1 PDB entry)

8. Domain d1b8aa2: 1b8a A:104-438 [40765]
   Other proteins in same PDB: d1b8aa1, d1b8ab1
   complexed with atp, mn
   has additional insertions and/or extensions that are not grouped together

Details for d1b8aa2

PDB Entry: 1b8a, 1.9 Å

PDB Description: aspartyl-trna synthetase

PDB Compounds: (A:) protein (aspartyl-tRNA synthetase)

SCOPe Domain Sequences for d1b8aa2:

Sequence; same for both SEQRES and ATOM records:

>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Pyrococcus kodakaraensis [TaxId: 311400]}
plpldptgkvkaeldtrlnnrfmdlrrpevmaifkirssvfkavrdffhengfieihtpk
iiatateggtelfpmkyfeedaflaespqlykeimmasgldrvyeiapifraeehnttrh
lneawsidsemafiedeeevmsflerlvahainyvrehnakeldilnfeleepklpfprv
sydkaleilgdlgkeipwgedidtegerllgkymmenenaplyflyqypseakpfyimky
dnkpeicrafdleyrgveissggqrehrhdilveqikekglnpesfefylkafrygmpph
ggfglgaerlikqmldlpnirevilfprdrrrltp

Timeline for d1b8aa2:

• d1b8aa2 first appeared (with stable ids) in SCOP 1.55
  
• d1b8aa2 appears in SCOPe 2.07