SCOP 1.57: Domain d1asyb2: 1asy B:205-557

Lineage for d1asyb2 (1asy B:205-557)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (11 proteins)

6. Protein Aspartyl-tRNA synthetase (AspRS) [55696] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55697] (3 PDB entries)

8. Domain d1asyb2: 1asy B:205-557 [40764]
   Other proteins in same PDB: d1asya1, d1asyb1

Details for d1asyb2

PDB Entry: 1asy, 3 Å

PDB Description: class ii aminoacyl transfer rna synthetases: crystal structure of yeast aspartyl-trna synthetase complexed with trna asp

SCOP Domain Sequences for d1asyb2:

Sequence; same for both SEQRES and ATOM records:

>d1asyb2 d.104.1.1 (B:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae)}
pilledasrseaeaeaaglpvvnldtrldyrvidlrtvtnqaifriqagvcelfreylat
kkftevhtpkllgapseggssvfevtyfkgkaylaqspqfnkqqlivadfervyeigpvf
raensnthrhmteftgldmemafeehyhevldtlselfvfifselpkrfaheielvrkqy
pveefklpkdgkmvrltykegiemlraagkeigdfedlstenekflgklvrdkydtdfyi
ldkfpleirpfytmpdpanpkysnsydffmrgeeilsgaqrihdhallqermkahglspe
dpglkdycdgfsygcpphagggiglervvmfyldlknirraslfprdpkrlrp

Timeline for d1asyb2:

• d1asyb2 first appeared (with stable ids) in SCOP 1.55
  
• d1asyb2 appears in SCOP 1.59
  
• d1asyb2 appears in the current release, SCOPe 2.08