Lineage for d1asya2 (1asy A:205-557)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416610Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 416611Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 416612Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (14 proteins)
  6. 416622Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)
  7. 416626Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55697] (3 PDB entries)
  8. 416630Domain d1asya2: 1asy A:205-557 [40763]
    Other proteins in same PDB: d1asya1, d1asyb1

Details for d1asya2

PDB Entry: 1asy (more details), 3 Å

PDB Description: class ii aminoacyl transfer rna synthetases: crystal structure of yeast aspartyl-trna synthetase complexed with trna asp

SCOP Domain Sequences for d1asya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asya2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae)}
pilledasrseaeaeaaglpvvnldtrldyrvidlrtvtnqaifriqagvcelfreylat
kkftevhtpkllgapseggssvfevtyfkgkaylaqspqfnkqqlivadfervyeigpvf
raensnthrhmteftgldmemafeehyhevldtlselfvfifselpkrfaheielvrkqy
pveefklpkdgkmvrltykegiemlraagkeigdfedlstenekflgklvrdkydtdfyi
ldkfpleirpfytmpdpanpkysnsydffmrgeeilsgaqrihdhallqermkahglspe
dpglkdycdgfsygcpphagggiglervvmfyldlknirraslfprdpkrlrp

SCOP Domain Coordinates for d1asya2:

Click to download the PDB-style file with coordinates for d1asya2.
(The format of our PDB-style files is described here.)

Timeline for d1asya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1asya1