SCOP 1.67: Domain d1aszb2: 1asz B:205-557

Lineage for d1aszb2 (1asz B:205-557)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (14 proteins)

6. Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55697] (3 PDB entries)

8. Domain d1aszb2: 1asz B:205-557 [40762]
   Other proteins in same PDB: d1asza1, d1aszb1
   protein/tRNA complex; complexed with atp

Details for d1aszb2

PDB Entry: 1asz, 3 Å

PDB Description: the active site of yeast aspartyl-trna synthetase: structural and functional aspects of the aminoacylation reaction

SCOP Domain Sequences for d1aszb2:

Sequence; same for both SEQRES and ATOM records:

>d1aszb2 d.104.1.1 (B:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae)}
pilledasrseaeaeaaglpvvnldtrldyrvidlrtvtnqaifriqagvcelfreylat
kkftevhtpkllgapseggssvfevtyfkgkaylaqspqfnkqqlivadfervyeigpvf
raensnthrhmteftgldmemafeehyhevldtlselfvfifselpkrfaheielvrkqy
pveefklpkdgkmvrltykegiemlraagkeigdfedlstenekflgklvrdkydtdfyi
ldkfpleirpfytmpdpanpkysnsydffmrgeeilsgaqrihdhallqermkahglspe
dpglkdycdgfsygcpphagggiglervvmfyldlknirraslfprdpkrlrp

Timeline for d1aszb2:

• d1aszb2 first appeared (with stable ids) in SCOP 1.55
  
• d1aszb2 appears in SCOP 1.65
  
• d1aszb2 appears in SCOP 1.69
  
• d1aszb2 appears in the current release, SCOPe 2.08