Lineage for d1asza2 (1asz A:205-557)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332805Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 332806Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 332807Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (12 proteins)
  6. 332814Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)
  7. 332818Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55697] (3 PDB entries)
  8. 332820Domain d1asza2: 1asz A:205-557 [40761]
    Other proteins in same PDB: d1asza1, d1aszb1

Details for d1asza2

PDB Entry: 1asz (more details), 3 Å

PDB Description: the active site of yeast aspartyl-trna synthetase: structural and functional aspects of the aminoacylation reaction

SCOP Domain Sequences for d1asza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asza2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae)}
pilledasrseaeaeaaglpvvnldtrldyrvidlrtvtnqaifriqagvcelfreylat
kkftevhtpkllgapseggssvfevtyfkgkaylaqspqfnkqqlivadfervyeigpvf
raensnthrhmteftgldmemafeehyhevldtlselfvfifselpkrfaheielvrkqy
pveefklpkdgkmvrltykegiemlraagkeigdfedlstenekflgklvrdkydtdfyi
ldkfpleirpfytmpdpanpkysnsydffmrgeeilsgaqrihdhallqermkahglspe
dpglkdycdgfsygcpphagggiglervvmfyldlknirraslfprdpkrlrp

SCOP Domain Coordinates for d1asza2:

Click to download the PDB-style file with coordinates for d1asza2.
(The format of our PDB-style files is described here.)

Timeline for d1asza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1asza1