Lineage for d1asza2 (1asz A:205-557)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82887Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 82888Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 82889Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (11 proteins)
  6. 82896Protein Aspartyl-tRNA synthetase (AspRS) [55696] (4 species)
  7. 82900Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55697] (3 PDB entries)
  8. 82902Domain d1asza2: 1asz A:205-557 [40761]
    Other proteins in same PDB: d1asza1, d1aszb1

Details for d1asza2

PDB Entry: 1asz (more details), 3 Å

PDB Description: the active site of yeast aspartyl-trna synthetase: structural and functional aspects of the aminoacylation reaction

SCOP Domain Sequences for d1asza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asza2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae)}
pilledasrseaeaeaaglpvvnldtrldyrvidlrtvtnqaifriqagvcelfreylat
kkftevhtpkllgapseggssvfevtyfkgkaylaqspqfnkqqlivadfervyeigpvf
raensnthrhmteftgldmemafeehyhevldtlselfvfifselpkrfaheielvrkqy
pveefklpkdgkmvrltykegiemlraagkeigdfedlstenekflgklvrdkydtdfyi
ldkfpleirpfytmpdpanpkysnsydffmrgeeilsgaqrihdhallqermkahglspe
dpglkdycdgfsygcpphagggiglervvmfyldlknirraslfprdpkrlrp

SCOP Domain Coordinates for d1asza2:

Click to download the PDB-style file with coordinates for d1asza2.
(The format of our PDB-style files is described here.)

Timeline for d1asza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1asza1