Lineage for d6zoo3_ (6zoo 3:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633630Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 2633631Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 2633682Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 2633683Protein automated matches [276200] (4 species)
    not a true protein
  7. 2633718Species Pea (Pisum sativum) [TaxId:3888] [276203] (9 PDB entries)
  8. 2633729Domain d6zoo3_: 6zoo 3: [407604]
    Other proteins in same PDB: d6zooa_, d6zoob_, d6zooc_, d6zood_, d6zooe1, d6zooe2, d6zoof_, d6zooj_, d6zoop_
    automated match to d5l8r3_
    complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6zoo3_

PDB Entry: 6zoo (more details), 2.74 Å

PDB Description: photosystem i reduced plastocyanin complex
PDB Compounds: (3:) Chlorophyll a-b binding protein 3, chloroplastic

SCOPe Domain Sequences for d6zoo3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zoo3_ f.43.1.0 (3:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
rplwfaskqslsyldgslpgdygfdplglsdpegtggfieprwlaygevingrfamlgav
gaiapeylgkvglipqetalawfqtgvippagtynywadnytlfvlemalmgfaehrrfq
dwakpgsmgkqyflglekgfggsgnpaypggpffnplgfgkdekslkelklkevkngrla
mlailgyfiqglvtgvgpyqnlldhvadpvnnnvltslkfh

SCOPe Domain Coordinates for d6zoo3_:

Click to download the PDB-style file with coordinates for d6zoo3_.
(The format of our PDB-style files is described here.)

Timeline for d6zoo3_: