Lineage for d1eova2 (1eov A:205-557)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1920670Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1920687Protein Aspartyl-tRNA synthetase (AspRS) [55696] (5 species)
  7. 1920688Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55697] (3 PDB entries)
  8. 1920689Domain d1eova2: 1eov A:205-557 [40760]
    Other proteins in same PDB: d1eova1

Details for d1eova2

PDB Entry: 1eov (more details), 2.3 Å

PDB Description: free aspartyl-trna synthetase (asprs) (e.c. 6.1.1.12) from yeast
PDB Compounds: (A:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1eova2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pilledasrseaeaeaaglpvvnldtrldyrvidlrtvtnqaifriqagvcelfreylat
kkftevhtpkllgapseggssvfevtyfkgkaylaqspqfnkqqlivadfervyeigpvf
raensnthrhmteftgldmemafeehyhevldtlselfvfifselpkrfaheielvrkqy
pveefklpkdgkmvrltykegiemlraagkeigdfedlstenekflgklvrdkydtdfyi
ldkfpleirpfytmpdpanpkysnsydffmrgeeilsgaqrihdhallqermkahglspe
dpglkdycdgfsygcpphagggiglervvmfyldlknirraslfprdpkrlrp

SCOPe Domain Coordinates for d1eova2:

Click to download the PDB-style file with coordinates for d1eova2.
(The format of our PDB-style files is described here.)

Timeline for d1eova2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eova1