Lineage for d1eova2 (1eov A:205-557)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) 
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins) 
Protein Aspartyl-tRNA synthetase (AspRS) [55696] (4 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55697] (3 PDB entries) 
Domain d1eova2: 1eov A:205-557 [40760]
Other proteins in same PDB: d1eova1
Details for d1eova2
PDB Entry: 1eov (more details), 2.3 Å
PDB Description: free aspartyl-trna synthetase (asprs) (e.c. 6.1.1.12) from yeast
SCOP Domain Sequences for d1eova2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae)}
pilledasrseaeaeaaglpvvnldtrldyrvidlrtvtnqaifriqagvcelfreylat
kkftevhtpkllgapseggssvfevtyfkgkaylaqspqfnkqqlivadfervyeigpvf
raensnthrhmteftgldmemafeehyhevldtlselfvfifselpkrfaheielvrkqy
pveefklpkdgkmvrltykegiemlraagkeigdfedlstenekflgklvrdkydtdfyi
ldkfpleirpfytmpdpanpkysnsydffmrgeeilsgaqrihdhallqermkahglspe
dpglkdycdgfsygcpphagggiglervvmfyldlknirraslfprdpkrlrp
SCOP Domain Coordinates for d1eova2:
Click to download the PDB-style file with coordinates for d1eova2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eova2:
- d1eova2 appears in SCOP 1.57
- d1eova2 appears in the current release, SCOPe 2.08
View in 3D
