Lineage for d6zoo2_ (6zoo 2:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028373Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 3028374Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 3028425Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 3028426Protein automated matches [276200] (4 species)
    not a true protein
  7. 3028483Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries)
  8. 3028501Domain d6zoo2_: 6zoo 2: [407593]
    Other proteins in same PDB: d6zooa_, d6zoob_, d6zooc_, d6zood_, d6zooe1, d6zooe2, d6zoof_, d6zooj_, d6zool_, d6zoop_
    automated match to d5l8r2_
    complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6zoo2_

PDB Entry: 6zoo (more details), 2.74 Å

PDB Description: photosystem i reduced plastocyanin complex
PDB Compounds: (2:) Chlorophyll a-b binding protein, chloroplastic

SCOPe Domain Sequences for d6zoo2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zoo2_ f.43.1.0 (2:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
tvaepdrplwfpgstpppwldgslpgdfgfdplglgsdpeslrwnvqaelvhsrwamlga
agifipefltklgilntpswytageqeyftdtttlfivelvfigwaegrrwadilnpgcv
ntdpifpnnkltgtdvgypgglwfdplgwgsaspqklkelrtkeikngrlamlavmgawf
qhiytgtgpidnlfahladpghatifaa

SCOPe Domain Coordinates for d6zoo2_:

Click to download the PDB-style file with coordinates for d6zoo2_.
(The format of our PDB-style files is described here.)

Timeline for d6zoo2_: