SCOP 1.75: Domain d1qf6a4: 1qf6 A:242-532

Lineage for d1qf6a4 (1qf6 A:242-532)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)

6. Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species)

7. Species Escherichia coli [TaxId:562] [55695] (5 PDB entries)

8. Domain d1qf6a4: 1qf6 A:242-532 [40759]
   Other proteins in same PDB: d1qf6a1, d1qf6a2, d1qf6a3
   complexed with aet, amp, dhu, g7m, psu, zn

Details for d1qf6a4

PDB Entry: 1qf6, 2.9 Å

PDB Description: structure of e. coli threonyl-trna synthetase complexed with its cognate trna

PDB Compounds: (A:) threonyl-tRNA synthetase

SCOP Domain Sequences for d1qf6a4:

Sequence; same for both SEQRES and ATOM records:

>d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

Timeline for d1qf6a4:

• d1qf6a4 first appeared (with stable ids) in SCOP 1.55
  
• d1qf6a4 appears in SCOP 1.73
  
• d1qf6a4 appears in SCOPe 2.01
  
• d1qf6a4 appears in the current release, SCOPe 2.08