Lineage for d1qf6a4 (1qf6 A:242-532)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34950Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
  4. 34951Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 34952Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalyic domain [55682] (9 proteins)
  6. 35047Protein Threonyl-tRNA synthetase (ThrRS) [55694] (1 species)
  7. 35048Species Escherichia coli [TaxId:562] [55695] (4 PDB entries)
  8. 35057Domain d1qf6a4: 1qf6 A:242-532 [40759]
    Other proteins in same PDB: d1qf6a1, d1qf6a2, d1qf6a3

Details for d1qf6a4

PDB Entry: 1qf6 (more details), 2.9 Å

PDB Description: structure of e. coli threonyl-trna synthetase complexed with its cognate trna

SCOP Domain Sequences for d1qf6a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

SCOP Domain Coordinates for d1qf6a4:

Click to download the PDB-style file with coordinates for d1qf6a4.
(The format of our PDB-style files is described here.)

Timeline for d1qf6a4: