Lineage for d1evkb2 (1evk B:242-532)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426347Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1426348Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1426349Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1426549Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species)
  7. 1426550Species Escherichia coli [TaxId:562] [55695] (5 PDB entries)
  8. 1426559Domain d1evkb2: 1evk B:242-532 [40758]
    Other proteins in same PDB: d1evka1, d1evkb1
    complexed with thr, zn

Details for d1evkb2

PDB Entry: 1evk (more details), 2 Å

PDB Description: crystal structure of a truncated form of threonyl-trna synthetase with the ligand threonine
PDB Compounds: (B:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1evkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evkb2 d.104.1.1 (B:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]}
rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagf

SCOPe Domain Coordinates for d1evkb2:

Click to download the PDB-style file with coordinates for d1evkb2.
(The format of our PDB-style files is described here.)

Timeline for d1evkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1evkb1