SCOPe 2.08: Domain d6zoof_: 6zoo F:

Lineage for d6zoof_ (6zoo F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families)
   automatically mapped to Pfam PF02507

5. Family f.23.16.0: automated matches [276195] (1 protein)
   not a true family

6. Protein automated matches [276199] (5 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276202] (9 PDB entries)

8. Domain d6zoof_: 6zoo F: [407568]
   Other proteins in same PDB: d6zoo1_, d6zoo2_, d6zoo3_, d6zoo4_, d6zooa_, d6zoob_, d6zooc_, d6zood_, d6zooe1, d6zooe2, d6zooj_, d6zool_, d6zoop_
   automated match to d5l8rf_
   complexed with 3ph, bcr, ca, chl, cl0, cla, cu, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6zoof_

PDB Entry: 6zoo, 2.74 Å

PDB Description: photosystem i reduced plastocyanin complex

PDB Compounds: (F:) Photosystem I reaction center subunit III

SCOPe Domain Sequences for d6zoof_:

Sequence; same for both SEQRES and ATOM records:

>d6zoof_ f.23.16.0 (F:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
diagltpckdskqfakrekqsikklesslklyapdsapalainatiektkrrfdnygkqg
llcgadglphlivsgdqrhwgefitpgilflyiagwigwvgrsyliairddkkptqkeii
idvplatglvfrgfswpiaayrellngelvakdv

Timeline for d6zoof_:

• d6zoof_ first appeared in SCOPe 2.07